PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000136226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 488aa    MW: 55096.4 Da    PI: 7.2833
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000136226genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-094154492155
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    k +yps++++  LA+++gL+++q+ +WF N+R ++
  MDP0000136226 415 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 449
                    569*****************************885 PP

2ELK40.65.3e-14369390122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qLlrKYsgyLgsLkqEF+
  MDP0000136226 369 ELKGQLLRKYSGYLGSLKQEFM 390
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.5E-5130172IPR005540KNOX1
PfamPF037904.5E-11131155IPR005540KNOX1
PfamPF037904.9E-5192212IPR005540KNOX1
SMARTSM012561.3E-24226277IPR005541KNOX2
PfamPF037911.7E-20230276IPR005541KNOX2
SMARTSM011882.8E-8369390IPR005539ELK domain
PROSITE profilePS5121311.174369389IPR005539ELK domain
PfamPF037898.6E-11369390IPR005539ELK domain
PROSITE profilePS5007112.989389452IPR001356Homeobox domain
SuperFamilySSF466892.52E-19391465IPR009057Homeodomain-like
SMARTSM003897.4E-13391456IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-28394454IPR009057Homeodomain-like
CDDcd000866.77E-12401453No hitNo description
PfamPF059209.7E-17409448IPR008422Homeobox KN domain
PROSITE patternPS000270427450IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MEGGGANGTC SMMAFGENSS NGGGMCPRMM MPLMTSSHHA HHSHHHLHQH HMNLNPNADT  60
HDTSTTHQFR QLPQLPQLPP SNNHHDHQNP HNTSGGSSFL LHNPAAAAAS YFMDNNNNDG  120
VGGSSSSSPS TVKAKIMAHP HYHRLLASYI NCQKIKRENL VDMRLKGIDN SCFPPRFFGK  180
FGSEYLNIHV LIVIMKVGAP PEVVARLEEA CASAATVGQM VSSSSESGSL GEDPALDQFM  240
EAYCEMLTKY EQEISKPFKE AMIFLQRIES QFKALTLSCS SDSAVSSQTL RAVVDSWCPN  300
TMIPKELSWW WCKWPVITEI MFVLIDKERP AGRCPKTCYG DGIDRNHVSS EEEVDVNNNF  360
IDPQAEDREL KGQLLRKYSG YLGSLKQEFM KKRKKGKLPK EARQQLLDWW SRHYKWPYPS  420
ESQKLALAES TGLDQKQINN WFINQRKRHW KPSEDMQFVV MDASHQGHYY MDSVMGNPFP  480
MDISPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1384393LKQEFMKKRK
2390394KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116591e-177stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3642321e-155DQ364232.1 Prunus dulcis homeodomain protein Kn1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384102.10.0PREDICTED: homeobox protein knotted-1-like LET6 isoform X1
SwissprotP466081e-125HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE91e-175D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGVIT_10s0116g00190.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.13e-81KNOX/ELK homeobox transcription factor